PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna14666.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 336aa    MW: 37348.3 Da    PI: 4.844
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna14666.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.49.1e-153178148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g W++eEde+l ++    G g+W+ +ar  g+ R++k+c++rw +yl
  mrna14666.1-v1.0-hybrid 31 KGLWSPEEDEKLMRYMLNNGQGCWSDVARNAGLERCGKSCRLRWINYL 78
                             678*******************************************97 PP

2Myb_DNA-binding48.81.6e-1584127146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg+++++E++l+++ + +lG++ W+ Ia++++ gRt++++k++w++
  mrna14666.1-v1.0-hybrid  84 RGAFSPQEEDLIIHFHSLLGNR-WSQIAARLP-GRTDNEIKNFWNS 127
                              89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.8E-232581IPR009057Homeodomain-like
PROSITE profilePS5129416.9342678IPR017930Myb domain
SuperFamilySSF466891.09E-2729125IPR009057Homeodomain-like
SMARTSM007179.0E-113080IPR001005SANT/Myb domain
PfamPF002492.1E-133178IPR001005SANT/Myb domain
CDDcd001677.46E-93478No hitNo description
PROSITE profilePS5129424.73279133IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-2582133IPR009057Homeodomain-like
SMARTSM007174.4E-1583131IPR001005SANT/Myb domain
PfamPF002491.3E-1484127IPR001005SANT/Myb domain
CDDcd001671.27E-1086126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007027developmental stagewhole plant fruit formation stage 70% to final size
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MRKPEPYAVS NTGGKNNKNN SGMSSNNKLR KGLWSPEEDE KLMRYMLNNG QGCWSDVARN  60
AGLERCGKSC RLRWINYLRP DLKRGAFSPQ EEDLIIHFHS LLGNRWSQIA ARLPGRTDNE  120
IKNFWNSTIK KRLKILSSSS STASPNASDS SSEQPNNNDF FAAAGGGGGF MNIIPPSMMP  180
IYPDSSMQAT SLINHMFDPF PMVEHGGYYN NGNPCTAQIG SVGSGSSTGD DCGFGQNIDV  240
FGNVNMRVEE DIYVPPLESV STIDHDQNNL KTETIFYDHN NYYSNTNNII KGENMIGVGN  300
YFEDDHQDQG LTMGEWDLED LMKDVSSFPL LDYQS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27291335108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8285510.0FR828551.1 Rosa rugosa mRNA for putative MYB transcription factor (myb18 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004291790.10.0PREDICTED: transcription factor MYB46
TrEMBLF2QKX10.0F2QKX1_R
STRINGGLYMA11G14200.21e-112(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.11e-70myb domain protein 83